| Rosetta 3.1 Release Manual |
rosetta_source/test/integration/tests/membrane_abinitio for an example membrane ab initio run and input files../bin/membrane_abinitio2.linuxgccrelease -in:file:native BRD4.pdb (or -in:file:fasta BRD4_.fasta) -in:file:spanfile BRD4.span -in:file:lipofile BRD4.lips4 -in:file:frag3 aaBRD4_03_05.200_v1_3 -in:file:frag9 aaBRD4_09_05.200_v1_3 -in:path:database ../rosetta_database -abinitio:membrane -membrane:no_interpolate_Mpair -membrane:Menv_penalties -nstruct 1 -score:find_neighbors_3dgrid -mute all
Membrane ab initio protocol specific input files (BRD4.span and BRD4.lips4 in the above example) generated using octopus2span.pl, run_lips.pl, and alignblast.pl scripts located in /rosetta_source/src/apps/public/membrane_abinitio/ . Note that blastpgp and nr database are necessary to run run_lips.pl script.
octopus2span.pl <OCTOPUS topology file> example: <path to mini>/rosetta_source/src/apps/public/membrane_abinitio/octopus2span.pl BRD4.octopus
Sample OCTOPUS topology file:
############################################################################## OCTOPUS result file Generated from http://octopus.cbr.su.se/ at 2008-09-18 21:06:32 Total request time: 6.69 seconds. ############################################################################## Sequence name: BRD4 Sequence length: 123 aa. Sequence: PIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFV WWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGA GIV OCTOPUS predicted topology: oooooMMMMMMMMMMMMMMMMMMMMMiiiiMMMMMMMMMMMMMMMMMMMMMooooooMMM MMMMMMMMMMMMMMMMMMiiiiiiiiiiiiiiiiiiiiiMMMMMMMMMMMMMMMMMMMMM ooo
Sample span file:
TM region prediction for BRD4 predicted using OCTOPUS 4 123 antiparallel n2c 6 26 6 26 31 51 31 51 58 78 58 78 97 117 97 117
1st line is comment line. 2nd line shows number of predicted transmembrane helices (4 in the example above) and total number of residues (123 in the example above). 3rd line shows predicted topology of transmembrane helices in the membrane (currently only antiparallel topology is implemented). 4th line and all lines below show start and end residue numbers of each of the predicted transmembrane helices (current format repeats these numbers twice).
run_lips.pl <fasta file> <span file> <path to blastpgp> <path to nr database> <path to alignblast.pl script> example: ./rosetta_source/src/apps/public/membrane_abinitio/run_lips.pl BRD4.fasta BRD4.span ~/blast/bin/blastpgp /scratch/shared/genomes/nr ./rosetta_source/src/apps/public/membrane_abinitio/alignblast.pl
Lipid exposed data: resnum mean-lipo lipophil entropy
6 -1.000 3.004 1.211
9 -1.000 2.268 2.137
10 -1.000 4.862 1.095
13 -1.000 1.304 1.552
16 -1.000 3.328 2.025
...
-abinitio:membrane
-in:file:native inputs/BRD4.pdb
-in:file:frag3 inputs/aaBRD4_03_05.200_v1_3
-in:file:frag9 inputs/aaBRD4_09_05.200_v1_3
-in:file:spanfile inputs/BRD4.span
-in:file:lipofile inputs/BRD4.lips4
-membrane:no_interpolate_Mpair
-membrane:Menv_penalties
-score:find_neighbors_3dgrid
-out:nstruct 1
-out:file:silent BRD4_silent.out
-mute all
For more information about membrane ab initio modeling flags, please check the @ref options "options list"
Please note:
-membrane:no_interpolate_Mpair
This flag will switch off the interpolation between the two layers for the pair-term to mimic the old code
-membrane:Menv_penalties
This flag will switch on the following penalties:
* no non-helical secondary structure fragments in predicted transmembrane helical regions in the hydrophobic layer of the membrane.
* no N- and C- termini residues of predicted transmembrane helical regions in the hydrophobic layer of the membrane.
* no transmembrane helices with orientation >45 degrees relative to the membrane normal vector.
-smooth_move_frac flag is not being used and will be removed in the next release.
@section result Result Interpretation
During membrane ab initio run, protocol generates pdb files and an energy file.
Membrane ab initio application specific score outputs in the energy file are:
@verbatim
Mpair membrane pairwise residue interaction energy
Menv membrane residue environment energy
Mcbeta membrane residue centroid density energy
Mlipo membrane residue lipophilicity energy
Menv_hbond membrane non-helical secondary structure in the hydrophobic layer penalty
Menv_termini membrane N- and C-temini residue in the hydrophobic layer penalty
Menv_tm_proj transmembrane helix projection penalty
1.5.2