You are here

Structure prediction

RosettaAntibody3 core.pose.util error

Category: 
Structure prediction

I'm using rosetta_src_2020.08.61146_bundle. I'm trying to use the RosettaAntibody3 workflow as documented here, but am running into the following error when I run the following command:

module load rosetta/2020.08 blast/2.10.0+ gcc/9.1.0
antibody.default.linuxgccrelease -ignore_unrecognized_res true -fasta IL6antibody.fasta -out:path:all antibodied

Here is the IL6antibody.fasta file:

Post Situation: 

Comparative modeling of metalloproteins

Category: 
Structure prediction

Hi,

Hope everybody is doing well. 

I'm just getting used to using Rosetta and would appreciate some pointers with regards to comparative modeling of metalloproteins. 

I have a protein (155 amino acids) that binds to Zn. I know exactly which amino acids the zn atoms interacts with and I have 2 homologs for templates with homology in the 65% region. I've been reading this tutorial

Post Situation: 

manually defining CDRs in antibody modelling

Category: 
Structure prediction

Hi all,

I'm trying to use the antibody executable to create a model of an exisiting antibody. I have the CDR sequences that I need to model, so I created a fasta file and tried to run it. However, I get this error:

File: src/protocols/antibody/grafting/chothia_numberer.cc:149
ERROR: Unxpected length of h1 [length=3], length expected to be: [6, 7, 8, 9, 10, 11, 12, 13]!

Post Situation: 

Unrecognized atom parameter with denovo_density

Category: 
Structure prediction

I've run into an issue building a model using denovo_density in step 4D of this protocol: https://faculty.washington.edu/dimaio/files/rosetta_density_tutorial_aug18_4.pdf,

The rosetta command that throws the error is:

Post Situation: 

Clustering error - Help, please

Category: 
Structure prediction

Hi, I'm trying to group structures into clusters, but I have an error and an empty log file. A few months ago (in February / March) I didn't have a problem with it, although I did it in the same way (I think so). I have no idea where this problem comes from.

Using the AbinitioRelax protocol, I obtained a silent file with 100,000 structures (centroid representations) for a certain amino acid sequence. Now I want to group the structures into clusters and sort by energy. I use the following commands:

Post Situation: 

metalloprotein ab initio with glutamic acid

Category: 
Structure prediction

Hi all,

I'm new to rosetta design and looking to do ab initio folding for my first metalloprotein design. I saw the documentation (https://www.rosettacommons.org/docs/latest/application_documentation/structure_prediction/metalloprotein-abrelax), looked at the test inputs, and read the original paper. All of these only address His and Cys as ligands. Is there a way to do other ligands such as Glu or Asp?

Post Situation: 

RosettaCM: An internal error has occurred when "Running the Hybridize mover"

Category: 
Structure prediction

Hello,

I am trying to replicate the tutorial for RosettaCM according to the following URL:

https://www.rosettacommons.org/docs/latest/application_documentation/structure_prediction/RosettaCM

The step 1 (using setup_RosettaCM.py) is fine where I can obtain the thread pdb file and flags and rosetta_cm.xml.

But when I tried to run step 2 (Run the Hybridize mover). It crashed.

Post Situation: 

"Residue 7 was disulfide bonded but had no partner" with antibody.linuxgccrelease

Category: 
Structure prediction

Dear all,

I am trying to modeling a camelid antibody with the sequence (nb.fasta) as following:

$cat nb.fasta

>heavy
QVQLQESGGGLVQAGGSLRLSCAASGTIFETEGMGWYRQAPGKEREFVATIGGGSITYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVIAFTEHKYSYWGQGTQVTVSSLE

 

I use antibody.linuxgccrelease to model it:

Post Situation: 

Pages

Subscribe to RSS - Structure prediction