You are here

Structure prediction

RosettaCM: An internal error has occurred when "Running the Hybridize mover"

Category: 
Structure prediction

Hello,

I am trying to replicate the tutorial for RosettaCM according to the following URL:

https://www.rosettacommons.org/docs/latest/application_documentation/structure_prediction/RosettaCM

The step 1 (using setup_RosettaCM.py) is fine where I can obtain the thread pdb file and flags and rosetta_cm.xml.

But when I tried to run step 2 (Run the Hybridize mover). It crashed.

Post Situation: 

"Residue 7 was disulfide bonded but had no partner" with antibody.linuxgccrelease

Category: 
Structure prediction

Dear all,

I am trying to modeling a camelid antibody with the sequence (nb.fasta) as following:

$cat nb.fasta

>heavy
QVQLQESGGGLVQAGGSLRLSCAASGTIFETEGMGWYRQAPGKEREFVATIGGGSITYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVIAFTEHKYSYWGQGTQVTVSSLE

 

I use antibody.linuxgccrelease to model it:

Post Situation: 

Problems with mpi version of antibody.linuxgccrelease

Category: 
Structure prediction

Dear all, 

When I run the "antibody.mpi.linuxgccrelease", like

     antibody.mpi.linuxgccrelease -fasta vhh.fasta -vhh_only | tee grafting.log

I always get the following strange information when the program approachs finishing and all grafted models have been produced:

Post Situation: 

The usage of antibody_H3.linuxgccrelease

Category: 
Structure prediction

Dear all,

I am trying to use the antibody utinity to modeling a camelid antibody (vhh). I used the antibody.linuxgccrelease to produce 10 relaxed models for this  vhh sequence. Then I moved to do the H3 modeling. The "antibody_H3.linuxgccrelease --help" command shows many options for the antibody_H3.linuxgccrelease. However, I am a bit confused about the antibody_H3.linuxgccrelease options.

Post Situation: 

RosettaAntibodyDesign: How can I run the protocol without allowing design?

Category: 
Structure prediction
Docking
Design

Hi there,

I am trying to use RosettaAntibodyDesigner without allowing any design elements of the protocol to occur. I understand 100% that this would remove the intended purpose and use cases of RAbD, however, I am trying to piecemeal a side-by-side comparison of a designed mAb (which works reat through this protocol) and a non-designed mAb. 

However, I would like to ensure that both my simulations are executred identially otherwise. (ie., loop flexibility in docking, etc).

Is there any way to runn RAbD while FIXing all the CDRs?

Post Situation: 

Modelling temperature dependent RNA structures

Category: 
Structure prediction
Nucleic Acids

Hi to all,

I am really new to rosetta. I am using rna_denovo to generate 3D structures of RNA. I believe the default tempertaure used for modelling is 300K. I want to know if we can set our own temperature  for modelling RNA ? I did saw the option of temperature in the -help, written as 2 in the settings option, but I am not sure how to use it. Can we just define the temperature that we want, after writing this option? I am not sure how to go about this.

Please let me know the best way to go about this. And many thanks.

Post Situation: 

RosettaAntibodyDesign] How can I use run_relax and run_snugdock as part of my command and workflow?

Category: 
Structure prediction
Docking

I am trying to run a basic antibody/antigen design/dock simulaton using RosettaAntibodyDesign (from Rosetta 3.12)

I am using the command:

antibody_designer.macosclangrelease \
  -database /path/to/database/ \
  -do_dock \
  -use_epitope_constraints \
  -nstruct 5 -in:file:s complex_renumbered.pdb \
  -seq_design_cdrs H1 H2 H3 \
  -primary_cdrs H3 \
  -mintype relax \
  -run_snugdock \
  -run_relax \
  -out:path:all ./output 

 

Post Situation: 

How to fold-and-dock in PyRosetta?

Category: 
Structure prediction
Docking
Symmetry
PyRosetta

I'd like to do something similar to regular Rosetta fold-and-dock but in PyRosetta.  I've looked at D060_Folding.py and D100_Docking.py examples and while I (mostly) understand what each is doing, I have no idea how to combine them.

How to get a foldtree with symmetry? (in my case it's just simple C3) 

How to combine folding and docking?  Just alternate calls to folding.apply(test_pose) and dock_prot.apply(test_pose)?  (It can't be that simple...)

Post Situation: 

Pages

Subscribe to RSS - Structure prediction