Dear all,
I submitted the sequeces for the variable regions of the heavy and light chains of a antibody to ROSIE in order to predict the 3d structures. However when the job finished there seemed no structure output. The following is the output message:
Antibody script failed with message: Rosetta Antibody script [Python, version 2.0]. Starting... Could not find output/details/... creating it... Output prefix: output/ Blast database: /home/rosie/rosie/rosie.back/data/antibody/scripts/blast_database Antibody database: /home/rosie/rosie/rosie.back/data/antibody/scripts/antibody_database rosetta_bin: /home/rosie/rosie/rosie.back/data/antibody/bin [platform: static.linuxgccrelease] rosetta_database: /home/rosie/rosie/rosie.back/data/antibody/rosetta_database Using full antibody database (no homolog exclusion) Idealize: False Relax: True Light chain: DVVMTQSPSFLSASVGDRVTITCRASQDITINLNWFQHKPGKAPKRLIYVASRLERGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNNYPLTFGPGTKLDIKRTV Heavy chain: EVQLVQSGGGLVQPGGSMRLSCEASGLSLSDYFMHWVRQAQGKGLEWIGLIQTKAFTYKTEYPAAVKGRFTISRDDSKNTLYLQMSSLKPEDTALYYCIAVTPDFYYWGQGVLVTVSS L1 detected: RASQDITINLN (11 residues at positions 23 to 33) L3 detected: QQYNNYPLT ( 9 residues at positions 88 to 96) L2 detected: VASRLER (7 residues at positions 49 to 55) FR_L1: DVVMTQSPSFLSASVGDRVTITC FR_L2: WFQHKPGKAPKRLIY FR_L3: GVPSRFSGSGSGTEFTLTISSLQPEDFATYYC FR_L4: FGPGTKLDIKRT L segments: DVVMTQSPSFLSASVGDRVTITC RASQDITINLN WFQHKPGKAPKRLIY VASRLER GVPSRFSGSGSGTEFTLTISSLQPEDFATYYC QQYNNYPLT FGPGTKLDIKRT H1 detected: GLSLSDYFMH (10 residues at positions 25 to 34) H3 detected: VTPDFYY (7 residues at positions 100 to 106) H2 detected: LIQTKAFTYKTEYPAAVKG (19 residues at positions 49 to 67) FR_H1: EVQLVQSGGGLVQPGGSMRLSCEAS FR_H2: WVRQAQGKGLEWIG FR_H3: RFTISRDDSKNTLYLQMSSLKPEDTALYYCIA FR_H4: WGQGVLVTVSS H segments: EVQLVQSGGGLVQPGGSMRLSCEAS GLSLSDYFMH WVRQAQGKGLEWIG LIQTKAFTYKTEYPAAVKG RFTISRDDSKNTLYLQMSSLKPEDTALYYCIA VTPDFYY WGQGVLVTVSS Running /home/rosie/prefix/blast+/bin/blastp I: Queryname=FRL I: Found 600 blast results (limit 600) Could not find output/details/filters/... creating it... FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb FRL template: pdb1dql_chothia.pdb I: Queryname=FRH I: Found 600 blast results (limit 600) FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb FRH template: pdb3eot_chothia.pdb I: Queryname=light I: Found 600 blast results (limit 600) light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb light template: pdb3uc0_chothia.pdb I: Queryname=heavy I: Found 600 blast results (limit 600) heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb heavy template: pdb1ad0_chothia.pdb I: Queryname=L1 I: Found 342 blast results (limit 600) L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb L1 template: pdb1ikf_chothia.pdb I: Queryname=L2 I: Found 70 blast results (limit 600) L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb L2 template: pdb1ai1_chothia.pdb I: Queryname=L3 I: Found 170 blast results (limit 600) L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb L3 template: pdb2cmr_chothia.pdb I: Queryname=H1 I: Found 22 blast results (limit 600) H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb H1 template: pdb1uj3_chothia.pdb I: Queryname=H2 I: Found 58 blast results (limit 600) H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb H2 template: pdb2bmk_chothia.pdb I: Queryname=H3 I: Found 0 blast results (limit 600) WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query H3 template: pdb2xkn_chothia.pdb I: Queryname=light_heavy I: Found 600 blast results (limit 600) light_heavy template: pdb1dql_chothia.pdb light_heavy template: pdb1dee_chothia.pdb light_heavy template: pdb1hez_chothia.pdb light_heavy template: pdb2wuc_chothia.pdb light_heavy template: pdb3eo9_chothia.pdb light_heavy template: pdb3bn9_chothia.pdb light_heavy template: pdb3k2u_chothia.pdb light_heavy template: pdb3skj_chothia.pdb light_heavy template: pdb1dfb_chothia.pdb light_heavy template: pdb1jpt_chothia.pdb Running ProFit... profit < output/details/profit-H.in > output/details/profit-H.out sh: /bin/profit: Permission denied
Could anyone tell me why the job failed? And how at the end Running ProFit got "Permission denied" error?
Best regards
Yeping Sun
Category:
Post Situation:
Thank you for letting us know! This looks like a server error, could you please tell me the job number so we can troubleshoot it?
The job number is 33960
Hi Sergey,
I just ran into the very same problem with job no 69652 . Has anybody placed an additional installation of profit into /bin ?
Cheers,
Steffen
This shold be fixed now. Could you please try to re-submit your jobs?