The Grishin format is a Rosetta-specific multiple sequence alignment format. It is primarily used with the partial_thread application in Rosetta. Each template/target pair is specified on 6 lines with the following format:

## hsIGF 1k3dA_renum
#
scores_from_program: 0
0 KVTVDTVCKRGFLIQMSGHLECKCEND-VLVNEETCEEKVLKCDE
0 AVTVDTICKNGQLVQMSNHFKCMCNEGLVHLSENTCEEKN-CKKE
--

In the above, the '##', '#', and 'scores_from_program: 0' lines must be present. On the '##' line, there should be two identifiers. The first identifies the "target name" and the second identifies the "template name". The target name is unused by Rosetta, while the template name is used for both input and output names:

  • The first five characters are used to identify which input PDB is to be aligned.
  • The full name is used for the output file

Note: The output files will be named after the corresponding name in the Grishin alignment file. Furthermore, this name has to be at least 5 characters long. If your name in the alignment file is the same as your input file name, the input file will be overwritten! Thus, it is recommended to use "XXXXX_thread" in the alignment file, where 'XXXXX.pdb' is the pdb file of the template; the partial_thread application will then produce XXXXX_thread.pdb.

Multiple alignments may be concatenated in a single file:

## hsIGF 1k3d.templ
#
scores_from_program: 0
0 KVTVDTVCKRGFLIQMSGHLECKCEND-VLVNEETCEEKVLKCDE
0 AVTVDTICKNGQLVQMSNHFKCMCNEGLVHLSENTCEEKN-CKKE
--
## hsIGF 1y12.templ
#
scores_from_program: 0
0 DVTVETVCKRGNLIQRSG---CKCENDLVLVNHETCEEKVLKCDL
0 AVTVDTICKNGQLVQMSNHFKCMCNEGLVHLSENTCEEKN-CKKE
--

Multiple alignments should be written to the same alignment file.

If your alignment starts at a different position in the template, you can change the numbers at left of the format or add - where they need to be.

## 1xxx 1yyy.pdb
# hhsearch
scores_from_program: 1.0 0.0
7 AAAAAAA
0 AAAAAAA
--

Alternately, you can add the N term residues unaligned to the ali file:

## 1xxx 1yyy.pdb
# hhsearch
scores_from_program: 1.0 0.0
0 AAAAAAAAAAAAAA
0 -------AAAAAAA