Rosetta 3.3
Sequence Fasta File

Sequence data contains sequences of residues without structural data. The derivation and accuracy of such files is the subject of research but the formats tend to be simple.

Name

*.fasta

Purpose

Sequence information generated by the FASTA sequence alignment package.

Note on PDB format for RNA

The format of FASTA is described here

Example

In this example 2ptl_ is the identifier (using the name of the PDB). 1-120 describes the range of residues the file contains. : Example B.9. FASTA

>2ptl_ 1-120
VTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVAD
KGYTLNIKFAAAAAVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKD
NGEYTVDVADKGYTLNIKFA
 All Classes Namespaces Files Functions Variables Typedefs Enumerations Enumerator Friends Defines