Structure prediction

Hi all,

I'm trying to use the antibody executable to create a model of an exisiting antibody. I have the CDR sequences that I need to model, so I created a fasta file and tried to run it. However, I get this error:

File: src/protocols/antibody/grafting/chothia_numberer.cc:149
ERROR: Unxpected length of h1 [length=3], length expected to be: [6, 7, 8, 9, 10, 11, 12, 13]!

Hi, I'm trying to group structures into clusters, but I have an error and an empty log file. A few months ago (in February / March) I didn't have a problem with it, although I did it in the same way (I think so). I have no idea where this problem comes from.

Using the AbinitioRelax protocol, I obtained a silent file with 100,000 structures (centroid representations) for a certain amino acid sequence. Now I want to group the structures into clusters and sort by energy. I use the following commands:

Hello,

I am trying to replicate the tutorial for RosettaCM according to the following URL:

https://www.rosettacommons.org/docs/latest/application_documentation/structure_prediction/RosettaCM

The step 1 (using setup_RosettaCM.py) is fine where I can obtain the thread pdb file and flags and rosetta_cm.xml.

But when I tried to run step 2 (Run the Hybridize mover). It crashed.

Dear all,

I am trying to modeling a camelid antibody with the sequence (nb.fasta) as following:

$cat nb.fasta

>heavy
QVQLQESGGGLVQAGGSLRLSCAASGTIFETEGMGWYRQAPGKEREFVATIGGGSITYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVIAFTEHKYSYWGQGTQVTVSSLE

I use antibody.linuxgccrelease to model it: